SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000046129 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000046129
Domain Number 1 Region: 8-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 2.22e-68
Family TRADD, N-terminal domain 0.0000000421
Further Details:      
 
Domain Number 2 Region: 203-287
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000137
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000046129
Sequence length 294
Comment (Pan troglodytes)
Sequence
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPL
QPPVPSLSEVKPNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYER
EGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA
Download sequence
Identical sequences 9598.ENSPTRP00000046129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]