SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000047240 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000047240
Domain Number 1 Region: 185-431
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.87e-85
Family Eukaryotic proteases 0.00000000654
Further Details:      
 
Domain Number 2 Region: 20-82
Classification Level Classification E-value
Superfamily GLA-domain 2.35e-25
Family GLA-domain 0.0000916
Further Details:      
 
Domain Number 3 Region: 106-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000443
Family EGF-type module 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000047240
Sequence length 433
Comment (Pan troglodytes)
Sequence
SVFLDHENANKILNRPKRYNSGKLEEFVQGNLERECMEEKCSFEEAREVFENTERTTEFW
KQYVDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNS
ADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAE
TILDNITQSTQSFNDFTRVVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHC
VDTGVKITVVAGEHNIEETEHTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLN
SYVTPICIADKEYTNIFLKFGSGYVSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKF
TIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVS
RYVNWIKEKTKLT
Download sequence
Identical sequences ENSPTRP00000047240 9598.ENSPTRP00000047240 ENSPTRP00000047240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]