SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000047494 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000047494
Domain Number 1 Region: 483-793
Classification Level Classification E-value
Superfamily L domain-like 2.72e-46
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 2 Region: 38-434
Classification Level Classification E-value
Superfamily L domain-like 1.29e-38
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 3 Region: 881-1037
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.96e-33
Family Toll/Interleukin receptor TIR domain 0.0000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000047494
Sequence length 1048
Comment (Pan troglodytes)
Sequence
VFPMWTLKIQILILFNIILISKLLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPG
GIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPR
SFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLGQ
NCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNMIAKIQ
EDDFNNLNQLQILDLSGNCPRCYNAPFPCTPCKNNSPLQIPVNAFDALTELKVLRLHSNS
LQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPNLIQLDLSFNFELQVYRASMN
LSQAFSSLKSLKILRIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIANLSMFKQFK
RLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCRFKNKE
ASFMSVNESCYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPL
GELRYLDFSNNRLDLLHSTAFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKL
MMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKNS
LSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWNKLQCLKNLETLDLSHNQLTTVPERLSNC
SRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLLH
HNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNLI
LFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTKD
PAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKY
AKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQA
HPYFWQCLKNTLATDNHVAYSQVFKETV
Download sequence
Identical sequences S5Q3J2
ENSPTRP00000047494 9598.ENSPTRP00000047494 ENSPTRP00000047494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]