SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000048075 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000048075
Domain Number 1 Region: 107-291
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 6.15e-51
Family Isochorismatase-like hydrolases 0.0000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000048075
Sequence length 298
Comment (Pan troglodytes)
Sequence
MAAAEPAVLALPNSGAGGAGAPSGTVPVLFCFSVFARPSSVPHGAGYELLIQKFLSLYGD
QIDMHRKFVVQLFAEEWGQYVDLPKGFAVSERCKVRLVPLQIQLTTLGNLTPSSTVFFCC
DMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIVTEQYPKGLGSTVQEIDLTGVKLVL
PKTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGVEVHIVADATSSR
SMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Download sequence
Identical sequences G1RP92 G3RAI7 H2R5E6 Q96CN7
NP_057132.2.87134 NP_057132.2.92137 XP_001160234.1.37143 XP_003259964.1.23891 XP_004042490.1.27298 9598.ENSPTRP00000048075 9606.ENSP00000173527 ENSPTRP00000048075 ENSP00000421273 ENSGGOP00000012460 ENSPTRP00000048075 ENSP00000173527 ENSGGOP00000012460 ENSNLEP00000015056 ENSNLEP00000015056 gi|103471987|ref|NP_057132.2| ENSP00000173527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]