SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000048987 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000048987
Domain Number 1 Region: 41-549
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 4e-191
Family Myeloperoxidase-like 0.00000000000000578
Further Details:      
 
Domain Number 2 Region: 1-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000699
Family EGF-type module 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000048987
Sequence length 567
Comment (Pan troglodytes)
Sequence
NPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLL
THGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDFISWESFSNVSYYTRILP
SVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTS
GKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLM
HYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTR
LILIGETIRIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPD
SFKMGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHVLHVAVDVIR
ESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCH
PNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTK
TCPYVSFRVPDASQDDGPAVERPSTEL
Download sequence
Identical sequences ENSPTRP00000048987 ENSPTRP00000048987 9598.ENSPTRP00000048987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]