SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000053527 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000053527
Domain Number 1 Region: 490-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 200-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 323-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 238-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000028
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 365-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000167
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 451-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000019
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 113-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000239
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  9598.ENSPTRP00000053527
Domain Number - Region: 77-124
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000126
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 287-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000239
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number - Region: 425-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.013
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000053527
Sequence length 577
Comment (Pan troglodytes)
Sequence
MSESWQQPPQTQPQQPQPPQPQHHAEPPPALAEHTLPPGTAENPLGCAVYGILLQPDPGL
QPPQHAPLQAAGEPGPKCGVCGHDLAHLSSPHEHQCLAGHDRSFQCTQCLKIFHQATDLL
EHQCVQAEQKPFVCGVCKMGFSLLTSLAQHHSSHSGLVKCSICEKTYKPAEAAEPATTAA
PSLPAAPAPSTVTPAEQADKPYSCPICQKPFKHLSELSRHERIHTGEKPYKCTLCDKSFS
QSSHLVHHKRTHSSERPYKCAVCEKTFKHRSHLVRHMYAHSGEHHLFRCNVCELHFKESS
ELLQHPCTPSGERPFRCGECQKAFKRPSDLRQHERTHSAERPFKCDLCPMGFKQQYALMR
HRRTHKTEEPFKCGLCEKGFGQPSHLLYHQHVHTLETLFKCPVCQKGFDQSAELLRHKCL
PGAAERPFKCPVNKAYKRASAQKHQCAAAEKPLRCTLCERRFFSSSEFVQHRCDPAREKP
LKCPDCEKRFKYASDLQRHRRVHTGEKPYKCPNCDKAFKQREHLNKHQGVHAREQQFKCV
WCGERFLDVALLQEHSAQHSAAAAAAEGAYQVAACLP
Download sequence
Identical sequences ENSPTRP00000053527 9598.ENSPTRP00000053527 ENSPTRP00000053527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]