SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000053783 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000053783
Domain Number 1 Region: 32-309
Classification Level Classification E-value
Superfamily L domain-like 4.51e-52
Family Ngr ectodomain-like 0.009
Further Details:      
 
Domain Number 2 Region: 407-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000108
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 458-540
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000238
Family Fibronectin type III 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000053783
Sequence length 673
Comment (Pan troglodytes)
Sequence
MCSRVPLLLPLLLLLALGPGVQGCPSGCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVF
ENGITMLDAGSFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETF
RGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNS
LLALEPGILDTANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVPPVIRGLRG
LTRLRLAGNTRIAQLRPEDLAGLAALQELDVSNLSLQALPGDLSGLFPRLRLLAAARNPF
NCVCPLSWFGPWVRESHVTLASSEETRCHFPPKNAGRLLLELDYADFGCPATTTTATVPT
TRPVVREPTALSSSLAPTWLSPTEPATEAPSPPSTAPPTVGPVPQPQDCPPSTCLNGGTC
HLGTRHHLACLCPEGFTGLYCESQMGQGTQPSPTPVTPRPPRSLTLGIEPVSPTSLRVGL
QRYLQGSSVQFRSLRLTYRNLSGPDKRLVTLRLPASLAEYTVTQLRPNATYSVCVMPLGP
GRVPEGEEACGEAHTPPAVHSNHAPVTQAREGNLPLLIAPALAAVLLAALAAVGAAYCVR
RGRAMAAAAQDKGQVGPGAGPLELEGVKVPLEPGPKATEGGGEALPSGSECEVPLMGFPG
PGLQSPLHAKPYI
Download sequence
Identical sequences H2RAE0
9598.ENSPTRP00000053783 ENSPTRP00000053783 ENSPTRP00000053783 XP_003315004.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]