SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000055996 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000055996
Domain Number 1 Region: 67-144
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.88e-20
Family Intermediate filament protein, coiled coil region 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000055996
Sequence length 295
Comment (Pan troglodytes)
Sequence
MELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAAQAELKEARR
QWHHLQVEIESLHAVERGLENSLHASEQHYQMQLQDLETVIEGLEKELQEVRRGIEKQLQ
EHEMLLNTKMRLEQEIATYRRLLEKEEIRYYGCIQGGKKDKKPTTSRVGFVLPSAIINEI
SFTTKVPQKYENENVETVTKQAILNGSIVKESTEAHGTIQTEKVDEVIKEWEGSFFKDNP
RLRKKSVSLRFDLHLAATDEGCLETKQDNLPDIEVRLIMRRSCSIPSIKPPSTAN
Download sequence
Identical sequences H2NU70 H2RBN3
ENSPPYP00000009501 ENSPTRP00000055996 ENSPTRP00000055996 XP_003315496.1.37143 XP_009250087.1.23681 ENSPPYP00000009501 9598.ENSPTRP00000055996 9600.ENSPPYP00000009501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]