SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000056148 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000056148
Domain Number 1 Region: 289-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-54
Family SPRY domain 0.0000352
Further Details:      
 
Domain Number 2 Region: 4-77
Classification Level Classification E-value
Superfamily RING/U-box 8.84e-19
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 3 Region: 88-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000259
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000056148
Sequence length 475
Comment (Pan troglodytes)
Sequence
MACSLKDELLCSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEP
ALAPSLKLANIVERYSAFPLDAILNARRAARPCQAHDKVKLFCLTDRALLCFFCDEPALH
EQHQVTGIDDAFDELQREVKEQLQALQDSEREHTEALQLLKRQLAETKSSTKSLRTTIGE
AFERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRYSQQLRKVQEGAQILQERLAETD
RHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQYTIWKSLFQDIHPVPAALTLD
PGTAHQRLILSDDCTIVAYGNLHPQPLQDSPKRFDVEVSVLGSEAFSSGVHYWEVVVAEK
TQWVIGLAHEAASRKGSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVRDKLDKVGVFL
DYDQGLLIFYNADDMSWLYTFREKFPGKLCSYFSPGQSHANGKNVQPLRINTVRI
Download sequence
Identical sequences ENSPTRP00000056148 9598.ENSPTRP00000056148 ENSPTRP00000056148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]