SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000057473 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000057473
Domain Number 1 Region: 328-557
Classification Level Classification E-value
Superfamily L domain-like 1.59e-35
Family Ngr ectodomain-like 0.0029
Further Details:      
 
Domain Number 2 Region: 68-269
Classification Level Classification E-value
Superfamily L domain-like 5.44e-34
Family Ngr ectodomain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000057473
Sequence length 841
Comment (Pan troglodytes)
Sequence
MKLWIHLFYSSLLACISLHSQTPVFSSRGSCDSLCNCEEKDGTMLINCEAKGIKMVSEIS
VPPSRPFQLSLLNNGLTMLHTNDFSGLTNAISIHLGFNNIADIEIGAFNGLGLLKQLHIN
HNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIF
RFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKWACNCDLLQLKTWLENMPPQS
IIGDVVCNSPPLFKGSILSRLKKESICPTPPVYEEHEDPSGSLHLAATSSINDSRMSTKT
TSILKLPTKAPGLIPYITKPSTQLPGPYCPIPCNCKVLSPSGLLIYCQERNIESLSDLRP
PPQNPRKLILAGNIIHSLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNG
NHLTKLSKGMFLGLHNLEYLYLEYNAIKEILPGTFNPMPKLKVLYLNNNLLQVLPPHIFS
GVPLTKVNLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTV
TDDILCTSPGHLDKKELKALNSEILCPGLVNNPSMPTQTSYIIVTTPATTTNTADTILRS
LTDAVPLSVLILGLLIVFITIVFCAAGIVVLVLHRRRRYKKKQVDEQMRDNSPVHLQYSM
YGHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRS
LLERENNSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLGITEYLRKNIA
QLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQ
T
Download sequence
Identical sequences 9598.ENSPTRP00000057473 ENSPTRP00000057473 ENSPTRP00000057473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]