SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000059528 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000059528
Domain Number 1 Region: 1035-1160
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000324
Family GAF domain 0.023
Further Details:      
 
Weak hits

Sequence:  9598.ENSPTRP00000059528
Domain Number - Region: 859-912
Classification Level Classification E-value
Superfamily EF-hand 0.000162
Family Calbindin D9K 0.077
Further Details:      
 
Domain Number - Region: 286-361,388-414
Classification Level Classification E-value
Superfamily EF-hand 0.00091
Family Calmodulin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000059528
Sequence length 1504
Comment (Pan troglodytes)
Sequence
MNESASQEELRPAQENGKEDKERKWNLTEVKELHETLQQSVPDVPVKEDTNSVVEKAMDE
IKSQELNLEGQRKISPGSIKDSKTEASGNIAIRKSAKVIFALDETGLKSKPEHTWKKNLF
ERMEARAQAMQQKIIDKENLKKELEKKAEKKLPRDNLAKEWFNTESMTLNNSAYLLDKLL
PTLVPGVENILTQVEKKKVLTEAGTPSKFDPINYLGEYLIRNNPNYIKDPGMSGYQRVMK
EVTEDLKIYVPDTICNRVSKMKENIKQNRKQRESIDKIKVKVANTRKQALQEQFDEWILD
PKGMIPKSVIQNVLHEFFQNPDFKLGSHCKQLDITDSTEPRLNKMEFTEYISSHIKDLKS
EMFEELLKHLCHSADEFREVIKADMRRQMFAELFLHCDHGKVGFLDRQRTLALLELFYDH
SSQMLRSLLRNPRQWPFIEFEEINLTELWGDMDNQKHIYEGFDKVLLEMNTLLSANHASK
TQSKLLESPDQPKLDEQRTSTPSPNPPEQQKGVTAEQGPQRISTEEQQQGKKPTAEQELY
IESVTEPGTHTESTLEQGSSRGLLTEQETHRESTTEQGQHKGSIEGQGPRGVSVSEQGSS
RESVAEQGSRRESIAEQDRHKGSVAEQGSRRMSAAEQGSLRESIIEEPYQKSEQGPYGEI
ISEEQEDIGSTSKSRKDSILKSTKYGEPIPSEYIEVPLQEKRSWEQTYEEEIFLSSELQE
EVPTLSRKDHFPETTKKEVQKDKPCEPKSQKIEGKSWSGEFFTCNWKMKYVTFEDEEQAN
LIYGNSRFTDLHSIIRNIQSCKEVKGRTAFNGVSFNLLQFVQLLETFVGEDAPLSVSETL
TSFFKEGYVETEQEKMNALEQFSQNAFQVRQRLLLEAIFQKWDSDGSGFLDLKEVDELLY
TYKEGMEKESMKKAKLHIQFPKPHPGHEVRLSSKQFQNYIELVVSELRGNEDQVLESVVE
FLMNALERSHIESLRNCARRKWLHQIQCAAETSGVSLEPVYSETFKALTQDAEAHGNKKI
SAHISLLEENLLLPEKGNVLLRNVACTLDDAQFVLNRVLYRDMKGISFTVVDEGKPIHVP
QVQYHGNIFFWNQSRNKNDYNGSFLALPLQDAYMRIFGVLAVDTLRDPHEINIFLPHEIR
FYQGVANVFSTAYHYVHSREHILHIVITGIGWLYDVTSSITSITTYFVEPSPAQDSDYVL
RNMMVTGQLGLTEIHKNPPTIHRKSCIFRDFLFKCTDSSEVVLASACGETHIVVPLRERT
GEALGVLDFNIGQNRMLLCQEYKDLQKMMKVVQVACYEILGEFSGEIKKKYILEIENVRE
VQRAGILFFRIMLLELQESIQLLNSMEFVSLLLYDHTLVTEPNSPQDSKSMELEANVKLV
RDILKAVILFFHPELEFSSDFGSWDKCKFYVNKYLVNNICAFDPTAKHVEVNVQLIDEYI
RDHSRTEVWKFGNVVIEHLYHWIHICSALTKITKQLNSGITPPLPSKTDNYMYAKMPGEG
LQEK
Download sequence
Identical sequences H2RDY2
ENSPTRP00000059528 ENSPTRP00000059528 XP_001136207.1.37143 9598.ENSPTRP00000059528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]