SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000001915 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000001915
Domain Number 1 Region: 5-185
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 7.4e-35
Family D-ribulose-5-phosphate 3-epimerase 0.000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000001915
Sequence length 194
Comment (Pongo pygmaeus)
Sequence
MALGCKIGSPILNSNLASLEVKCLRILDSGHLDVMDGHFVPNITFGYPVVESFQKQLVQD
PFFDIHVMVSKLEQWVPIAIAEASQYTFHLEATKYSEALIEDIWENGMKVGLTIKPGTTV
EYLAPWTNQIDTALVITVEPGFGRQKFMDDMVPKAGANMIMSGSIVMRSEDPRSVIDLLR
NICSEATQKHSLDQ
Download sequence
Identical sequences H2N8C6
ENSPPYP00000001915 ENSPPYP00000001915 9600.ENSPPYP00000001915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]