SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000003807 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000003807
Domain Number 1 Region: 341-619
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-86
Family Eukaryotic proteases 0.000000000323
Further Details:      
 
Domain Number 2 Region: 104-197
Classification Level Classification E-value
Superfamily Kringle-like 7.25e-32
Family Kringle modules 0.000009
Further Details:      
 
Domain Number 3 Region: 210-297
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-27
Family Kringle modules 0.00000612
Further Details:      
 
Domain Number 4 Region: 45-105
Classification Level Classification E-value
Superfamily GLA-domain 1.55e-19
Family GLA-domain 0.0000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000003807
Sequence length 623
Comment (Pongo pygmaeus)
Sequence
MAHVRGLQLPGCLALAALCTLVHSQHVFLAPQQALSLLQRVRRANSVFLEEVRKGNLERE
CVEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGH
LNITQSGIQCQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQ
ECSIPVCGQDQVTVAMTPRSEGSGVNLSPPSEQCVPDRGQQYQGRLAVTTHGLPCLAWAS
AQAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAMEEET
GGGLDEDPDRAIEGRTATSEYQTFFDPRTFGSGEADCGLRPLFEKKSLEDKTERELLESY
IDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGATLISDRWVLTAAHCLLYPPWDKNFTE
NDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIH
PVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKVQPSVLQVVNLPIVERPVCKDS
TRIRITDNMFCAGKSPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGK
YGFYTHVFRLKKWIQKVIDQFGE
Download sequence
Identical sequences 9600.ENSPPYP00000003807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]