SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000003922 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000003922
Domain Number 1 Region: 27-183
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.56e-31
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 
Domain Number 2 Region: 201-280
Classification Level Classification E-value
Superfamily GAS2 domain-like 4.84e-30
Family GAS2 domain 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000003922
Sequence length 313
Comment (Pongo pygmaeus)
Sequence
MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEK
LDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKASAPSGSFFARDNTANFLSWC
RDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLS
APSPSPSPSSKSSGKKSTGNLLDDAVKRISEDPPCKCPNKFCVERLSQGRYRVGEKILFI
RMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYL
VVSANYKAKKEIK
Download sequence
Identical sequences H2NDV9
ENSPPYP00000003922 XP_002821996.1.23681 ENSPPYP00000003922 9600.ENSPPYP00000003922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]