SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000004311 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000004311
Domain Number 1 Region: 330-510
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.17e-36
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 2 Region: 55-145
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000585
Family Cadherin 0.0046
Further Details:      
 
Domain Number 3 Region: 606-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000166
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 4 Region: 531-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 5 Region: 568-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 2-61
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000314
Family Cadherin 0.014
Further Details:      
 
Weak hits

Sequence:  9600.ENSPPYP00000004311
Domain Number - Region: 300-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.039
Family Laminin-type module 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000004311
Sequence length 1097
Comment (Pongo pygmaeus)
Sequence
EEFVLDPHGILRSAVVFQHTESLEYVLCVQAKDSGKPQQVSHTYIRVRVIEESTHKPTAI
PLEIFIVTMEDDFPGGVIGKIHATDQDMYDVLTFALKSEQKSLFKVNSHDGKIIALGGLD
SGKYVLNVSVSDGRFQVPIDVVVHVEQLVHEMLQNTVTIRFENVSPEDFVGLHMHGFRRT
LRNAVLTQKQDSLHIISIQPVAGTNQLDMLFAVEMHSSEFYKPAYLIQKLSNARRHLENI
MRISAILEKNCSGLDCQEQHCEQGLSLDSHALMTYSTARISFVCPRFYRNVRCTCNGGLC
PGSNDPCVEKPCPGDMQCVGYEASRRPFLCQCPPGKLGECSGHTSLSFAGNSYIKYRLSE
NSKEENFKLALRLRTLQSNGIIMYTRANPCIILKIVDGKLWFQLDCGSGPGILGISGRAV
NDGSWHSVFLELNRNFTSLSLDDSYVERRRAPLYFQTLSTESSIYFGALVQADNIHSLTD
TRVTQVLSGFQGCLDSVILNNNELPLQNKRSSFAEVVGLTELKLGCVLYPDACERSPCQH
GGSCTGLPSGGYQCTCLSQFTGRNCESEITACFPNPCRNGGSCDPIGNTFICNCKAGLTG
VTCEEDINECEREECENGGSCVNVFGSFLCNCTPGYVGQYCGLRPVVVPNIQAGHSYVGK
EELIGIAVVLFVIFILVVLFIVFRKKVFRKNYSRNNITLVQDPATAALLNKSNGIPFRNL
RSSGDGRNVYQEVGPPQVPVRPMAYTPCFQSDSRSNLDKIVDGLGGEHQEMTTFHPESPR
ILTARRGVVVCSVAPNLPAVSPCRSDCDSIRKNGWDAGTENKGVDDPGEVTCFAGSNKGS
NSEVQSLSSFQSDSGDDNASIVTVIQLVNNVVDTIENEVSVMDQGQNYNRAYHWDTSDWM
PGARLSDIEEVPNYENQDGGSAHQGSTRELESDYYLGGYDIDSEYPPPHDEEFLSQDQLP
PPLPEDFPDQYEALPPSQPVSLASTLSPDCRRRPQFHPSQYLPPHPFPNETDLVGPPASC
EFSTFAVSMNQGTEPTGPADSVSLSLHNSRGTSSSDVSANCGFDDSEVAMSDYESVGELS
LASLHIPFVETQHQTQV
Download sequence
Identical sequences 9600.ENSPPYP00000004311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]