SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000004917 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9600.ENSPPYP00000004917
Domain Number - Region: 111-152
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0152
Family FCH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000004917
Sequence length 196
Comment (Pongo pygmaeus)
Sequence
MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIP
TFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKE
MDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEG
ERLEPFSMKPDRELRL
Download sequence
Identical sequences G3RZM1 H2NGM6 Q969J3
ENSGGOP00000021264 ENSP00000321546 ENSP00000321546 ENSP00000321546 gi|17157999|ref|NP_477517.1| NP_477517.1.87134 NP_477517.1.92137 XP_003826597.1.60992 XP_004052794.1.27298 GO.35257 HR2423 ENSGGOP00000021264 ENSPPYP00000004917 ENSPPYP00000004917 9600.ENSPPYP00000004917 9606.ENSP00000321546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]