SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000005437 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000005437
Domain Number 1 Region: 48-323
Classification Level Classification E-value
Superfamily L domain-like 3.51e-56
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 243-482
Classification Level Classification E-value
Superfamily L domain-like 8.5e-40
Family Ngr ectodomain-like 0.018
Further Details:      
 
Domain Number 3 Region: 547-848
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.03e-33
Family Rhodopsin-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000005437
Sequence length 907
Comment (Pongo pygmaeus)
Sequence
MDTSRLGVLLSLPVLLQLAAGGSSPRSGALLRGCPTHCHCEPDGRMLLRVDCSDLGLSEL
PSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLM
LQNNQLRQVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQ
AFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLD
LNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFVGRSA
FQHLPELRTLTLNGASQITEFPDLTGTANLESLTLTGAQISSLPQTVCNQLPNLQVLDLS
YNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPNAFST
LPSLIKLDLSAKLLSSFPVTGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCC
AFGVCENAYKISNQWNKGDNSSVDDLHKKDAGMFQVQDERDLEDFLLDFEEDLKALHSVQ
CSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALACNALVTSTAFRSSLYISPIKLLIGVIA
AVNMLTGVSSAVLAGVDAFTFGSFARHGAWWENGVGCQVIGFLSIFASESSVFLLTLAAL
ERGFSVKYSAKFETKAPFSSLKVIILLCALLALTMAAVPLLGGSKYGASPLCLPLPFGEP
STMGYMVTLILLNSLCFLMMTIAYTKLYCNLDKGDLENIWDCSMVKHIALLLFTNCILYC
PVAFLSFSSLLNLTFISPEVIKFILLVVVPLPACLNPLLYILFNPHFKEDLVSLGKQTYF
WTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSIAYDLPPSSMPSPAYPVTESCHLSS
VAFVPCL
Download sequence
Identical sequences H2NI23
ENSPPYP00000005437 ENSPPYP00000005437 9600.ENSPPYP00000005437 XP_002823562.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]