SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000005516 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000005516
Domain Number 1 Region: 38-452
Classification Level Classification E-value
Superfamily Sema domain 3.79e-49
Family Sema domain 0.0087
Further Details:      
 
Domain Number 2 Region: 1049-1178,1352-1501
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.69e-28
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 454-502
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000641
Family Plexin repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  9600.ENSPPYP00000005516
Domain Number - Region: 664-750
Classification Level Classification E-value
Superfamily E set domains 0.000462
Family E-set domains of sugar-utilizing enzymes 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000005516
Sequence length 1568
Comment (Pongo pygmaeus)
Sequence
MEVSRRKAPPRPPRPAAPLPLLAYLLALAAPGRGADEPVWRSEQAIGAIAASREDGVFVA
SGSCLDQLDYSLEHSLSRLYRDQAGNCTEPVSLAPPARPRPGSSFSKLLLPYREGAAGLG
GLLLTGWTFDRGACEVRPLGNLSRSSLRNGTEVVSCHPQGSTAGVVYRAGLNNRWYLAVA
ATYVLPEPETASRCNPAASDHDTAIALKDTEGRSLATQELGRLKLCEGAGSLHFVDAFLW
NGSIYFPYYPYNYTSGAATGWPSMARIAQSTEVLFQGQASLDCGHGHPDGRRLLLSSSLV
EALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFKTAESHCKEGDQP
ERVQPIASSTLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLKVILGENLTSNCPEVIYEIK
EETPVFYKLVPDPVKNIYIYLTAGKEVRRIRVANCNKHKSCSECLTATDPHCGWCHSLQR
CTFQGDCVHSENLENWLDISSGAKKCPKIQIIRSSKDKTTVTMVGSFSPRHSKCMVKNVD
SSRELCQNKSQPNRTCTCSIPTRATYKDVSVVNVMFSFGSWNLSDRFNFTNCSSLEECPA
CVETGCAWCKSARRCIHPFTACDPSDYERNQEQCPVAVEKTSGGGRPKENKGNRTNQALQ
VFYIKSIEPQKVSTLGKSNVIVTGANFTQASNITMILKGTSTCDKDVIQVSHVLNDTHMK
FSLPSSRKEMKDVCIQFDGGNCSSVGSLSYIALPHCSLIFPATTWISGGQNITMMGRNFD
VIDNLIISHELKGNINVSEYCVATYCGFLAPSLKSSKVRTNVTVKLRVQDTYLDCGTLQY
REDPRFTGYRVESEVDTELEVKIQKENDNFNISKKDIEITLFHGENGQLNCSFENITRNQ
DLTTILCKIKGIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIF
AAVGVTRHKSKELSRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKH
FALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTVIHTLEKQKNFS
VKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVEKLLTNW
MSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVPEFSTVA
LNVIFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLEL
QVGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHC
HLILPDSEAFQDVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSRA
PFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTPHIDG
CLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPPLSSSEM
EEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLERERGLEEAQKQLLHVKVLFD
EKKKCKWM
Download sequence
Identical sequences H2NI98
9600.ENSPPYP00000005516 ENSPPYP00000005516 ENSPPYP00000005516 XP_002823641.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]