SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000007778 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000007778
Domain Number 1 Region: 83-152
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000034
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000007778
Sequence length 269
Comment (Pongo pygmaeus)
Sequence
MAQPLCPPLSESWMLLSAAWGPTPRPPPSDKDCGRSLVSSPDSWGSTPADSPVPSPARPG
ARREPRAPSVGRRGARSSRLGSWQRQSASEREKLRMRTLARALHELRRFLPPSVAPAGQS
LTKIETLRLAIRYIGHLSAVLGLSEDSLQRRCRQRGDAGSPRGCPLCPDGCPAQMQTRTQ
AEGQGQGRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAMEPSPP
SPLLPGDVLALLETWMPLSPLEWLPEEPK
Download sequence
Identical sequences H2NPF6
9600.ENSPPYP00000007778 ENSPPYP00000007778 XP_002833924.1.23681 ENSPPYP00000007778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]