SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000008593 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000008593
Domain Number 1 Region: 62-172
Classification Level Classification E-value
Superfamily GINS helical bundle-like 4.39e-37
Family PSF2 C-terminal domain-like 0.000000542
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily PriA/YqbF domain 8.6e-22
Family PSF2 N-terminal domain-like 0.0000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000008593
Sequence length 185
Comment (Pongo pygmaeus)
Sequence
MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRL
LPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDM
WDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLEST
QSQDF
Download sequence
Identical sequences G3RNK0 H2NRP1 K7D3M4 Q9Y248
2e9xB ENSGGOP00000008866 ENSGGOP00000017367 9600.ENSPPYP00000008593 9606.ENSP00000253462 GO.35208 ENSGGOP00000008866 NP_057179.1.87134 NP_057179.1.92137 XP_002822898.1.23681 XP_002826768.1.23681 XP_004058140.1.27298 ENSPPYP00000008593 ENSPPYP00000008593 ENSP00000253462 ENSP00000253462 ENSP00000253462 gi|7706367|ref|NP_057179.1| 2e9x_B 2e9x_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]