SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000008918 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000008918
Domain Number 1 Region: 48-125
Classification Level Classification E-value
Superfamily HMG-box 4.19e-26
Family HMG-box 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000008918
Sequence length 232
Comment (Pongo pygmaeus)
Sequence
MALPGSSQDQAWSLEPPAPTAAASSSSGPQEREDAGSPAAPGALPLEKVKRPMNAFMVWS
SAQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHRDYPDYKYRPR
RKAKSSGAGLSRCGQGRGNLASGGPLWGPGYATTQPSRGFGYRPPNYSTAYLPGSYGSSH
CKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLSGAPMPLTHL
Download sequence
Identical sequences H2NSK7
9600.ENSPPYP00000008918 ENSPPYP00000008918 ENSPPYP00000008918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]