SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000009517 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000009517
Domain Number 1 Region: 416-609
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.3e-68
Family Nuclear receptor ligand-binding domain 0.0000242
Further Details:      
 
Domain Number 2 Region: 129-216
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.59e-19
Family Nuclear receptor 0.0000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000009517
Sequence length 612
Comment (Pongo pygmaeus)
Sequence
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTS
NITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSVCIN
RNRCQQCRFECLSWACLRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETSPT
QHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTY
AHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNILAAQRHNEALNGLRQAP
SSYPPTWSPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANDPRQGSSKNVLLACPMNM
YPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMV
RFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLNAMFDFSEKLNSLALTEEELGLFTA
VVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNNMH
SEKLLSFRVDAQ
Download sequence
Identical sequences H2NU86
9600.ENSPPYP00000009517 ENSPPYP00000009517 ENSPPYP00000009517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]