SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000011682 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000011682
Domain Number 1 Region: 122-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.36e-17
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 2 Region: 164-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000692
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000011682
Sequence length 264
Comment (Pongo pygmaeus)
Sequence
MDTPSPDPLPSPLPGEEEKPLALPPPVPRGRRGRRPGGATSSNRTLKASLPRKRGRPPKS
GQEPPLVQVQGVTAPVGSSGGSDLLLIDDQGVPYTVSEGSAAGPEGSGPRKAPHFCPVCL
RAFPYLSDLERHSISHSELKPHQCKVCGKTFKRSSHLRRHCNIHAGLRPFRCPLCPRRFR
EAGELAHHHRVHSGERPYQCPICRLRFTEANTLRRHAKRKHPEAMGVPLCAPDPGSEPSW
DEEGIPATAGAEEEEETEGKGEPA
Download sequence
Identical sequences H2P085
9600.ENSPPYP00000011682 XP_002829839.1.23681 XP_009231422.1.23681 ENSPPYP00000011682 ENSPPYP00000011682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]