SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000011997 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000011997
Domain Number 1 Region: 141-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000109
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 118-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000189
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  9600.ENSPPYP00000011997
Domain Number - Region: 210-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000357
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000011997
Sequence length 275
Comment (Pongo pygmaeus)
Sequence
MPKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDGGSSSGSGSG
SAGEPGGAESSSSPHAPERETPEPGDAEGPDGHLAAKQRPVARSKIKFTTGTCSDSVVHS
CDLCGKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCNVC
NKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGS
SFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK
Download sequence
Identical sequences H2P139
ENSPPYP00000011997 XP_002830032.1.23681 9600.ENSPPYP00000011997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]