SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000013015 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000013015
Domain Number 1 Region: 78-164
Classification Level Classification E-value
Superfamily HMG-box 4.32e-30
Family HMG-box 0.00000876
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily HMG-box 3.8e-24
Family HMG-box 0.0000077
Further Details:      
 
Weak hits

Sequence:  9600.ENSPPYP00000013015
Domain Number - Region: 167-211
Classification Level Classification E-value
Superfamily ARM repeat 0.000604
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000013015
Sequence length 211
Comment (Pongo pygmaeus)
Sequence
MGKGDPKKPRGKMSSYAFFVQTCQEEKKKKHPDASVNFSEFSKTCSERWKTISAKEKGKF
EDMVKADKARYEREMKTYIPPKGETKKKFKDLNAPKRTPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAVKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEEDEEDEEDEEEEEDEDDEEEEDD
Download sequence
Identical sequences H2P3W9
9600.ENSPPYP00000013015 ENSPPYP00000013015 ENSPPYP00000013015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]