SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000015506 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000015506
Domain Number 1 Region: 43-522
Classification Level Classification E-value
Superfamily Sema domain 6.02e-114
Family Sema domain 0.00000273
Further Details:      
 
Domain Number 2 Region: 681-769
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000191
Family Other IPT/TIG domains 0.069
Further Details:      
 
Domain Number 3 Region: 522-569
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000126
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 1091-1173
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000148
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 5 Region: 767-861
Classification Level Classification E-value
Superfamily E set domains 0.0000000117
Family Other IPT/TIG domains 0.042
Further Details:      
 
Domain Number 6 Region: 566-621
Classification Level Classification E-value
Superfamily E set domains 0.000000108
Family Other IPT/TIG domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000015506
Sequence length 1229
Comment (Pongo pygmaeus)
Sequence
MELLPPLPQSFLLLLLLPAEPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVT
YEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGSGPHGPPGDTDT
KVLVLEPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVAS
PLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPK
HLVSYSIEYVHSFHTGAFVYFLTVQPASVTDAPSALHTRLARLSATEPELGDYRELVLDC
RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVAGKDGGPGV
GPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELARSL
NYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIRGPGCRHFLTCGRCLRAQ
RFMGCGWCGNMCGQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG
LVPEGTHQVTVGQSPCWPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVT
NMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVN
GTECLLAQVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFHYREDPVVLSISPNCG
YINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAG
NLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTV
GGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLS
ILLPLLLLVAALATALVFSYWWRRQQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSG
LAFPATDGLDSTTCVHGASFSDSEDESCVPLLRKESIQLRDLDSALLAEVKDVLIPHERV
VTHSDRVIGKLDKSFTVKVADFGLARDILDKEYYSVRQHRHARLPVKWMALESLQTYRFT
TKSDVYQVMQQCWEADPAVRPTFGVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEM
NVHPEQPQSSPMPGSARRPRPLSEPPRPT
Download sequence
Identical sequences H2PAQ3
ENSPPYP00000015506 ENSPPYP00000015506 9600.ENSPPYP00000015506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]