SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000015715 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000015715
Domain Number 1 Region: 255-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-18
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 294-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 3-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-17
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Domain Number 4 Region: 208-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000431
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 336-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000837
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  9600.ENSPPYP00000015715
Domain Number - Region: 82-112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00688
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000015715
Sequence length 390
Comment (Pongo pygmaeus)
Sequence
LLTQQGTVTFADMALNFSQKKWSLLSEVQRCLYCDVMLKNLALLSSLGCWCGVKDEEAPG
KQSISIQRESQVRTLRAGGSSKKAHPCEMCSPILGDIFHLAQHQETHHKQKLNRSAHQKQ
HIGEKLDRRGAREASFVKSCKVHVSQEPFISYEVGKNFLPSLGLHQQEATHNVEKTNTET
KHGPPFHEGKTHYSCEEFIKNISAPLTHLFHQKLFTRKRSYECGQCGKCFRQKGNLIQHQ
RGHTGERPYERRKYRSHLLTDHQKLHTGERPYSCGECGKLFYKKSHFLLPERVHTGERPY
ECEVCGKLLSQKEHVTVHQRVHTGEGPYECNEHGKSFSYSSALRVHTRVCTGKPYEHTEC
GKSFAESSSLNIEELTVERPYECNERGKSF
Download sequence
Identical sequences H2PB98
ENSPPYP00000015715 9600.ENSPPYP00000015715 ENSPPYP00000015715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]