SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000015813 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000015813
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily HMG-box 3.93e-30
Family HMG-box 0.00000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000015813
Sequence length 240
Comment (Pongo pygmaeus)
Sequence
MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDE
AKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLS
APEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSL
SCPSQHTHTHPSPTNPGYVVPCNCTTWSASTLQPPVAYILFPGMTKTGIDPYSSAHATAM
Download sequence
Identical sequences H2PBI9
XP_002814130.1.23681 ENSPPYP00000015813 ENSPPYP00000015813 9600.ENSPPYP00000015813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]