SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000018045 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000018045
Domain Number 1 Region: 112-173
Classification Level Classification E-value
Superfamily RING/U-box 9.06e-17
Family ZZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 44-97
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000272
Family PB1 domain 0.0084
Further Details:      
 
Domain Number 3 Region: 390-431
Classification Level Classification E-value
Superfamily UBA-like 0.000000000179
Family UBA domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000018045
Sequence length 436
Comment (Pongo pygmaeus)
Sequence
MASLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAEAAAGPGPCERLLSRVAALFPALRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFS
HNRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGDARPGPTAESGAGPSEDPSVNFLKNV
GESVAAALSPLGIEVDIDVEHGGQKKPTPVSPESSSTEEKSSSQPSSCCSDPSKVGXVEG
ATQSLAEQMRKIALGNMFLFQEHMESDNCGGDEDWTHLSSKEVDPSNRMNLQSLQMPESE
GPSSLDPSQEGPTGLKTALYPHLPPGKADPRLIESLQMLSMGFSDEGGWLTRLLQTKEDI
GAALDTIQYSKASPRR
Download sequence
Identical sequences H2PHM0
9600.ENSPPYP00000018045 ENSPPYP00000018045 ENSPPYP00000018045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]