SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000018296 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000018296
Domain Number 1 Region: 48-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.33e-38
Family SCAN domain 0.0000688
Further Details:      
 
Domain Number 2 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.29e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 403-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 488-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.14e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 319-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 216-264
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000209
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000018296
Sequence length 546
Comment (Pongo pygmaeus)
Sequence
MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALAAEVSAPCSPARGPERSRQRFRGFR
YPEAAGPREALSRLRELCGQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPES
GEEVVVLLEYLERQLDEPAPQVPVGDQGQELLCCKMALLTQTQGSQSSQCQPVKALFKHE
SLGSQPLQDRVLQVPGLAQGGCCREDAMVASRLTPGSQGLLKMEDVALTLTPGWTQLDSS
QVNLYRDEKQENHSSLVSLGGEIQTKSRDLPPVKKLPEKEHGKISCHLREDIAQIPTCAE
AGEQEGRLQRKQKNAVGSRRHYCHECGKSFAQSSGLTKHRRIHTGEKPYECEDCGKTFIG
SSALVIHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCSL
LEHHKIHTGEKPYQCNMCGKAFRRNSHLLRHQRIHGDKNVQNPEHGESWESQGRTESQWE
NTEAPVSYKCNECERSFTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVG
KKILSQ
Download sequence
Identical sequences H2PIA2
ENSPPYP00000018296 ENSPPYP00000018296 XP_009239824.1.23681 9600.ENSPPYP00000018296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]