SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000018301 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000018301
Domain Number 1 Region: 39-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.6e-37
Family SCAN domain 0.0000708
Further Details:      
 
Domain Number 2 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 396-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-20
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 312-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-18
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 480-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 210-254
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000759
Family KRAB domain (Kruppel-associated box) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000018301
Sequence length 538
Comment (Pongo pygmaeus)
Sequence
MARELSESTALDAQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGSRERFRGFRYPEAAGP
REALSRLRELCRQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVRKQHPESGEEVVVL
LEYLERQLDEPAPQVSGVDQGQELLCCKMALLTPAPGSQSSQFQLMKALLKHESLGSQPL
QDRVLQVPVLAHGGCCREDAVVASRLTPESQGLLKVEDVALTLTPEWTQQDSSQGNLCRN
EKQENHGSLVSLGDEKQIKSRDLPPAEKLPEKEHGKISCHLTEDIAQIPTCAEAGEQEGR
LQRKQKNGTGGRRHICHECGKSFAQSSGLSKHRRIHTGEKPYECEECGKAFIGSSALVIH
QRVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHRIH
TGEKPYQCSMCGKAFRRSSHLLRHQRIHTGDKNVQETEQGEAWKSRMESQLENVETPMSY
KCNECERSFTQNTGLIEHQKIHTGEKPYQCNACGKGFTRISYLVQHQRSHVGKNILSQ
Download sequence
Identical sequences H2PIA7
ENSPPYP00000018301 9600.ENSPPYP00000018301 XP_002816634.1.23681 XP_009239834.1.23681 XP_009239835.1.23681 ENSPPYP00000018301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]