SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000018613 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9600.ENSPPYP00000018613
Domain Number - Region: 1048-1086
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000446
Family HkH motif-containing C2H2 finger 0.028
Further Details:      
 
Domain Number - Region: 974-1018
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.019
Family HkH motif-containing C2H2 finger 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000018613
Sequence length 2196
Comment (Pongo pygmaeus)
Sequence
MYRSISRSSVSSHRPKDDGGGFRGSSRGASRADYARDGRGDHPGDSGSRRRSPGLHSDSL
EKSLRITVGNDHFCVSTPERRRLSDRLGSPVDNLEDMDRDDLTDDSVFTRSSQCSRGLER
YISQEEGPLSPFLGQLDEDYRTKETFLHRSDYSPHISCHDELLRGTERNREKLKGYSIRS
EERSREAKRPRYDDTVKINSMGGDHPSFASGTRNYRQRRRSPSPRFLDPEFRELDLARRK
REEEEERSRSLSQELVGVDGGGTGCSIPGLSGVLTASEPGYSLHRPEEVSVMPKKSILKK
RIEVDIMEPSMQLESFSSSTSSSQDHPLYSGHPSLPLSGAIAAFASEIENKGTMVETALK
EPQGNLYQWGPLPGIPKDNSPLREKFGSFLCHKDNLDLKAEGPERHTDFLLPHERASQDG
SGFSRILSMLADSTSTQEKRRRSFPDIEDEEKFLYGDEEEDLKAESLPKPLGSSESEVMR
QKASSLPSSAPAVKLESLEETNPEYAKIHDLLKTIGLDIGVAEISQLAARTQERLHGKKP
SLRSSADRRSSVDRYFSADHCSSVDHRFSADRCSSVDHCFSADRRSSDPHRLESREAHHS
NTHSPEVSHPHPPSPVDPYLLTKNSPPFLKSDHPVGHISGPEVVGSGFQSSVAVRCMLPS
APSAPIRLPHTAALSQFHMPRASQFAAARIPPNYQGPAIPPASFDAYRHYMAYATSRWPM
YPTSQPSNHPVPEPHRIMPITKQATRSRPNLRVIPTVTPDKPKQKESLRGSIPAAQVPVQ
VSIPSLIRYNPEKISDEKNRASQKQKVIEEREKLKNDREARQKKMYYLRTELERLHKQQG
EMLRKKRREKDGHKDPLLVEVSRLQDNIMKDIAELRQEAEEAEKKQSELDKVAQILGINI
FDKSQKSLSDSKEPTEKPGKAEKSKSPEKVSSFSNSSSNKESKVNNEKFRTKSPKPAESP
QSATKQSDQPTAAYEYYDAGNHWCKDCNTICGTMFDFFTHMHNKKHTQTLDPYNRPWASK
TQSEAKQDAIKRTDKITVPAKGSEFLVPISGFYCQLCEEFLGDPISGEQHVKGHQHNEKY
KKYVDENPLYEERRNLDRQAGLAVVLETERRRQSELKRKLSEKPKEEKKEKKAKTVKEVK
EDDKVSEKLEDQLSEGRNSPEKAENKRNTGIKLQLKEEVKKESPTSSSFGKFSWKKPEKE
EEKSSVGTPSISKEEIVESSKTKEDAKTEAGKAKPIKIKLSGKTVVAHTSPWMPVVTTST
QTKIRPNLPIPSTVLRKSCSATMSKPAPLNTFLSIKSSGTTAKPLPVVKESSADLLLPPD
IISKAFGGEEVILKGSPEEKVVLAEKSEPSHLPEQILPPPPPPPPPPPPPPPVMPHPAVP
SPAQANAILAPVKSNPIVSQTLSPGFVGPNILNPVLPVAIMASAQPAAIPSDETAPGVSE
SDRDQTLFSVLVRPPPPLSSVFSEQAKKLEKRNSCLATANAKDLYDIFYSSGGKGAPETK
GAPETKLSGGPLANGENSNLSRTKSSDTSSTSALNSSASQEELHQGEGLVTAPIVSNSEK
PVAKTLVALGKWSVVEHVDPKSTGSTYGFLQPLTRLCQSRPYETITPKTDTLAIWTSSSF
QSDTSRDISPEKKSELDLEEPGPPGVEPPPQLLDIQCKESQKLVEIHLRESVNKDKESQE
LRKSEDCRESEIETNTELEGRVKELSEGIVDEGASTSIGPHSIEDSNLNHGNRYMWEGEV
KQPNLLMIDKEAEQSNKLMTGSETPSKVVIKLSPQACSFTKAKLDSFLSEARSLLNPQDT
PVKISAPELLLHSPARSAMCLTGSTQEQGVSVVSEEGLENSAPESASRTSRYRSLKLKRE
RSKDFQIKKIYELAVWDENKKRPETWESPEKPKAEALELQDVHPELTVTIESKALGDFEA
TDLKVEELTALGNLGDMPVDFCTTRVSPAHRSPTALSQKVCEENSVSSIGCNSSDSTDFE
PIPSFSGFPLDSPKTLVLDFETEGERNSSNPRSVRIPSPNILKTGLTENVDCGLGGLEGT
HQALDLLAGGMMPEEVKQSSQLDKQESLGLELKTINSAGLGPSPCLPDLVDFVTRTSGVQ
KDKLCSPPSEPGDPSKCSSLELGPLQLEISNASTTEVAILQADDDSGDPLNLVKAPVSRS
PPREQVIEDNMVPQEMPEQEATVGAIQDHTESSVHN
Download sequence
Identical sequences H2PJ53
ENSPPYP00000018613 ENSPPYP00000018613 9600.ENSPPYP00000018613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]