SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000018856 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000018856
Domain Number 1 Region: 1026-1292
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.16e-43
Family Extended AAA-ATPase domain 0.011
Further Details:      
 
Domain Number 2 Region: 1667-1924
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.64e-39
Family Extended AAA-ATPase domain 0.08
Further Details:      
 
Domain Number 3 Region: 301-590
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.13e-30
Family Extended AAA-ATPase domain 0.024
Further Details:      
 
Domain Number 4 Region: 658-715,794-956
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.28e-28
Family Nitrogenase iron protein-like 0.075
Further Details:      
 
Domain Number 5 Region: 1340-1545
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.76e-23
Family Extended AAA-ATPase domain 0.08
Further Details:      
 
Domain Number 6 Region: 1982-2038,2151-2199
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000034
Family Extended AAA-ATPase domain 0.049
Further Details:      
 
Domain Number 7 Region: 5241-5444
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000568
Family Integrin A (or I) domain 0.045
Further Details:      
 
Weak hits

Sequence:  9600.ENSPPYP00000018856
Domain Number - Region: 38-207
Classification Level Classification E-value
Superfamily ARM repeat 0.00733
Family Leucine-rich repeat variant 0.077
Further Details:      
 
Domain Number - Region: 2319-2492,2608-2733,2800-2891
Classification Level Classification E-value
Superfamily ARM repeat 0.0255
Family Clathrin adaptor core protein 0.067
Further Details:      
 
Domain Number - Region: 2924-2969
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 0.0353
Family Bacterial S-adenosylmethionine decarboxylase 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000018856
Sequence length 5454
Comment (Pongo pygmaeus)
Sequence
MEHFLLEVAAAPLRLIAANEKSRSELGRFLAKQVWTPQDRQCVLSTLAQLLLDKDCTVLV
GHQLRPLLLDLLERNAEAIKAGGQINHDLHERLCVSMSKLIGNHPDVLPFALRYFKDTSP
VFQRLFLESSDANPVRYGRRRMKLRDLMEAAYKFLQQEQSVFRELWDWSVCVPLLRSHDT
LVRWYTANCLALVTCMNEEHKLSFLKKIFNSDELIHFRLRLLEEAQLQDLEKALVLANPE
VSCWRKEKQLQYLQGHLVSSDLCPRVTAVCGVVLPRQPSAPGELGGNRSSSREQELALRS
YVLVESVCKNLQTLAMAVASQNAVLLEGPIGCGKTSLVEYLAAVTGRMKPPQLLKVQLGD
QTDSKMLLGMYRCTDVPGEFVWQPGILTQAATMGHWILLEDIDYAPLDVVSVLIPLLENG
ELLIPGRGDCLKVAPGFQFFATRRLLSCGGNWYRPLNSHATLLDKYWTKIHLDNLDKREL
NEILQSRYPSLLAVVDHLLDIYIQLTGEKHHCWSDSSVGCEQAPEEVSEARRENKRPTLE
GRELSLRDLLNWCNRIAHSFDSSSLSASLNIFQEALDCFTAMLSEHTSKLKMAEVIGSKL
NISRKKAEFFCQLYKPEIVINELDLQVGRVRLLRKQNEAVHIQREKFTFAATRPSSVLIE
QLAVCVSKGEPVLLVGETGTGKTSTVQYLAHITYKPVDHKLIWLPLREAFEELFAQTFSK
KQNFTFLGHIQTCYRQKRWYDLLRLMQHVHKSAVNKDGKDSETGLLIKEKWEAFGLRLSH
AQQQMKMTENTLLFAFVEGTLAQAVKKGEWILLDEINLAAPEILECLSGLLEGSSGSLVL
LDRGDTEPLVRHPDFRLFACMNPATDVGKRNLPPGIRNRFTELYVEELESKEDLQVLIVD
YLKGLSVNKNTVQGIINFYTALRKESGTKLVDGTGHRPHYSLRTLCRALRFAASNPCGNI
QRSLYEGFCLGFLTQLDRASHPIVQKLICQHIVPGNVKSLLKQPIPEPKGGRLIQVEGYW
IAVGDKEPTIDETYILTSSVKLNLRDIVRVVSAGTYPVLIQGETSVGKTSLIQWLAAATG
NHCVRINNHEHTDIQEYIGCYTSDSSGKLVFKEGVLIDAMRKGYWIILDELNLAPTDVLE
ALNRLLDDNRELLVTETQEVVKAHPRFMLFATQNPPGLYGGRKVLSRAFRNRFVELHFDE
LPSSELETILHKRCSLPPSYCSKLVKVMLDLQSYRRSSSVFAGKQGFITLRDLFRWAERY
RLAEQIEKEYDWLQHLANDGYMLLAGRVRKQEEVDVIQEVLEKHFKKKLCPQSLFSKENI
LKLLGKLSTQISTLESNFGHIVWTEGMRRLAMLVGRALEFGEPVLLVGDTGCGKTTICQV
FAALANQKLYSVSCHLHMETSDFLGGLRPVRQKPNDKEEIDTSRLFEWHDGPLIQAMKED
GFFLLDEISLADDSVLERLNLSPALRNRFTEIWCPQSTSREDLIQIISHNLRPGLCLGRV
DPKGSDIPEVMLDFIDWLTHQEFGRKCVVSIRDILSWVNFMNKMGEEAASKRPEIISTVT
TFVHAACLVYIDGIGSGVTSSGFGTALLARKECLKFLIKRLAKIVRLTEYQKNELKIYDR
MKAKEFTGIDNLWGIHPFFIPRGPVLHRNNIADYALSAGTTAMNAQRLLRATKLKKPILL
EGSPGVGKTSLVGALAKASGNTLVRINLSEQTDITDLFGADLPVEGGKGGEFAWRDGPLL
AALKAGHWVVLDELNLASQSVLEGLNACFDHRGEIYVPELGMSFQVQHEKTKIFGCQNPF
RQGGGRKGLPRSFLNRFTQVFVDPLTVIDMEFIASTLFPAIEKNIVKKMVAFNNQIDHEV
TVEKKWGQKGGPWEFNLRDLFRWCQLMLVDQSPGCYDPGQHVFLVYGERMRTEEDKKKVI
AVFKDVFGSNSNPYMGTRLFRITPYDVQLGYSVLSRGSCVPHPSRHPLLLLHQSFQPLES
IMKCVQMSWMVILVGPASVGKTSLVQLLAHLTGHTLKIMAMNSAMDTTELLGGFEQVDLI
RPWRRLLEKVEGTVRALLRDSLLISADDAEVVLRAWSHFLLTYKPKCLGEGGIAITMEIV
NKLEAVLLLMQRLNNKINSYSKAEFAKLVEEFRSFGVKLTQSASGRSHGTFEWVDSMLVQ
ALKSGDWLLMDNVNFCNPSVLDRLNALLEPGGVLTISERGMIDGSTPTITPNPNFSPTSS
VSTLIQTAVLIVQYLQRGLSLDRAFSEACWEVYVCSQHSPANRKLVQALLEKHVFSLRAH
ETWGDSILGMGLWPDSVPSALFATEDSHLSTVRRDGQILAYCLNRMSMKTSSWTRSQPLT
LQDLEKIMQSPSPENLKFNAVEVNTYWIDEPDVLAMAVKLLIERATNQDWMLRVKWLYHL
AKNIPQELESIQIHLEASAASLRNFYSHSLSGAVSNVFKILQPNTTDEFVIPLDPRWNMQ
ALDMIRNLMDFDPQTDQPDQLFALLESAANKTIIYLDREKRVFTEANLVSVGSKKLRDSV
LRMSFEFHQDPESYHTLPHEIVVNLAAFFELCDALVLLWVQSSQGMVSDASVNEILGSLR
WRDRFWTVADTVKVDAPGLALLALHWHWVLKHLVHQIPRLLMNYEDKYYKEVQTVSEHIQ
NCLGSQTGGFAGIKKLQKFLGRPFPFKDKLVVECFSQLKVLNKVLAIREQMSALGESGWQ
EDINRLQVVASQWTLKKSLLQAWGLILRANILEDVNLDELKNFVHAQCLELKAKGLSLGF
LEKKHDEASSLSHPDLTSIIHLTRSVQLWPAMEYLAMLWQYKVTADFMAQACLRRFSKNQ
QPQINEEISHLISFCLYHTPVTPQELRDLWSLLRHKTVSPEEITSLWSELFNSMFMSFWS
STVTTNPEYWLMWNPLPGMQQREAPKSVLDSTLKGPGNLNRPIFSKCCFEVLTSSWRASP
WDVSGLPILSSSHVTLGEWVERTQQLQDISSMLWTNMAISSVAEFRRTDSQLQGQVLFRH
LAGLAELLPESQRQEYMQNCDQLLFGSSQAFQHVGQTLGDMAGQEVLPKELLCQLLTSLH
HLFGEGESKRSLPEPAQRGSLWVSLGLLQIQTWLPQARFDPAVKREYKLNYAKEELHQLQ
CEWKTRNLSSQLQTGRDLEDEVVVSYSHPHVRTLRQRMDRLDNLTCRLLKKQAFRPQLPA
YESLVQEIHHYVTSIAKAPAVQDLLTRLLQALHMDGPRSAQVAQSLLKEEASWQQSHHQF
RKRLAEEYTFYPDAVSPLQASILQLQHGMRLVASELHTSLHSSMVGADGLGTLATALLAF
PSVGPTFPTYYAHADTLCSVKSEEVLRGLGKLILKRSGGKELEGKGQKACPTREQLLMNA
LLYLRSHVLCKGELDQRALQLFRHVCQEIINEWDEQERIAQEKAEQESSLYRYRSRNSRT
ALSDEEEEEREFRKQFPLHEKDFADILVQPTLEENKGTSDGQEEEAATNPALLSQNSMQA
VMLIHQQLCLNFARSLWYQQTLPPHEAKHYLSLFLSCYQTGASLVTHFYPLMGVELNDRL
LGSQLLACTLSHNTLFGEAPSDLMVKPDGPYDFYQHPNVPEARRCQPVLQGFSEAVSHLL
QDWPEHPALEQLLVIMDRIRSFPLSSPISKFLNGLEILLAKAQDWEENASRALSLRKHLD
SISQMIIRWRKLELNCWSMSLDNTMKRHTEKSTKHWFSIYQMLEKHMQEQTEEQEDDKQM
TLMLLVSTLQAFIEGSSLGEFHVRLQMLLVFHCHVLLMPQVEGKDSLCSVLWNLYHYYKQ
FFDRVQAKIVELRSPLEKELKEFVKISKWNDVSFWSIKQSVEKTHRTLFKFMKKFEAVLS
EPCRSSLVESDKEEQPDFLPRPTDGAASELSSVQNLNRALRETLLARPAAGQATIPEWCQ
GAAPSGLEGELLRRLPKLRKRMRKMCLMFMKDSPLPRLVEGLDQFTGEVISSVSELQSLK
VEPSAEKEKQRSEAKHILMQKQRALSDLFKHLAKIGLSYRKGLAWARSKNPQEMLHLHPL
DLRSALSIVSSTQEADSRLLTEISSSWDGCQKYFYRSLARHARLNAALATPAKEMGMGNV
ERCRGFSAHLMKMLVRQRRSLTTLSEQWIILRNLLSCVQEIHSRLMGPQAYPVAFPPQDG
VQQWTERLQHLAMQCQILLEQLSWLLQCCPSVGPAPGHGNVQVLGQPPAPCLERPELSKE
QLCGVVLDLIPSNLSYPSPIPGSQLPSGCRMRKQDQLWQQSTMRLTEMIKTIKTVKADVD
KIRQQSCETLFHSWKDFEVCSSALSCLSQVSVHLQGLESLFILPGMEVEQRDSQIALVES
LEYVRGEISKAMADFTTWKTHLLTSGSQGGNQMLDEGFVEDFSEQMEIAIRAILCAIQNL
EERKNEKAEENTDQASSQEEYAGFERLQSGHLTKLLEDDFWADVSTLHVQKIISAISELL
ERLKSYGEDGTAAKHLFFSQSCSLLVCLVPVLSSYSDLVLFFLTMSLATHRSTAKLLSVL
AQVFTELAQKGFCLPKEFMEDSAGEGATEFHDYEGGGIGEGEGMKDVSDQIENEEQVEDT
FQKGQEKDKEDPDSKSDIKGEDNAIEMLEDFDGKMHDGELEEQEEDDEKSDSEGGDLDKH
MGDLNGEEADKLDERLWGDDDEEEDEEEEDNKTEETGPGMDEEDSELVAKDDNLDNGNSN
KDKSQQDKKEEKEEAEADDGGQGEDKINEQIDEREYDENEVDPYHGNQEKVPEPEALDLP
DDLNFDSDDKNGGEDTDNEEGEEDNPLEIKEKPEEAGHEAEERGETETDQNESQSPQEPE
EGPSEDDKTEGEEEMDTGADDQDGDAAQHPEEHSEEQQQSLEEKDKEADEEGGDNGPADQ
GFQPQHEEEWEDSDTEEQVPEALERKEHASCGQTGVENMQSTQAMELAGDAPEKEQGKEE
HGSGAADANQAEGHESNFIAQLASQKHTRKNTQSFKRKPGQADNERSMGDHNERVHKRLR
TVDTDSHAEQGPAQQPQAQVEDADAFEHIKQGSDTYDAQTYDVASKEQQQSAKDSGKDQE
KEEIEDTLMDTEEQEELKAADVEQLKAEEIKSGTTAPLGFDEMEVEIQTVKTEEDQDPRT
DKAHKETENEKPERSQESTIHTAHQFLMDTIFQPFLKDVNELRQELERQLEMWQPRESGN
PEEEKVAAEMWQSYLILTTPLSQRLCEELRLILEPTQAAKLKGDYRTGKRLNIRKVIPYI
ASQFRKDKIWLRRTKPSKRQYQICLAIDDSSSMVDNHTKQLAFESLAVIGNALTLLEVGQ
IAVCSFGESVKLLHPFHEQFSDYSGSQILRLCKFQQKKTKIAQFLESVANMFAAAQQLSQ
NISSETAQLLLVVSDGRGLFLEGKERVLAAVQAARNANIFVIFVVLDNPSSRDSILDIKV
PIFKGPGEMPEIRSYMEEFPFPYYIILRDVNALPETLSDALRQWFELVTASDHP
Download sequence
Identical sequences H2PJT7
9600.ENSPPYP00000018856 ENSPPYP00000018856 ENSPPYP00000018856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]