SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000019112 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000019112
Domain Number 1 Region: 12-71
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000644
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 151-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000033
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 60-113
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000589
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000019112
Sequence length 463
Comment (Pongo pygmaeus)
Sequence
MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQK
SHQCAHCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDL
TCGVCALELGSTEVLLDHLKAHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTG
CKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALP
PFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLSSLHPSVSPGSPPPPLPC
HKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVN
LPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQ
QQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR
Download sequence
Identical sequences H2PKI4
ENSPPYP00000019112 9600.ENSPPYP00000019112 ENSPPYP00000019112 XP_002817486.1.23681 XP_002817488.1.23681 XP_003776981.1.23681 XP_003776982.1.23681 XP_009240589.1.23681 XP_009240590.1.23681 XP_009240591.1.23681 XP_009240592.1.23681 XP_009240593.1.23681 XP_009240594.1.23681 XP_009240595.1.23681 XP_009240597.1.23681 XP_009240598.1.23681 XP_009240599.1.23681 XP_009240600.1.23681 XP_009240601.1.23681 XP_009240602.1.23681 XP_009240603.1.23681 XP_009240604.1.23681 XP_009240605.1.23681 XP_009240606.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]