SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000019491 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000019491
Domain Number 1 Region: 49-140
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.87e-39
Family SCAN domain 0.0000465
Further Details:      
 
Domain Number 2 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 386-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 483-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.5e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 222-278
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000863
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 
Domain Number 6 Region: 355-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000274
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000019491
Sequence length 563
Comment (Pongo pygmaeus)
Sequence
MMTAESREATGLSPQAAPEKDGIVIVKVEEEDEEDHMWGQDSSLQDTPPPDPEIFRQRFR
RFCYQNTFGPREALSRLKELCHQWLRPEINTKEQILELLVLEQFLSILPKELQVWLQEYR
PDSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARGMVPLDPVQESSSFDLHHEATQSHF
KHSSRKPRLLQSRALPAAHIPAPPHEGSPRDQAMASALFTADSQAMVKIEDMAVSLILEE
WGCQNLARRNLSRDNKQENYGSAFPQGGENRNENEESTSKAETAEDSASHGETAGRFQKE
FGEKRDQEGKTGERQQKNPEEKTGKEKRDSGPATGKDKKTITGERGPREKGKGLGRSFSL
SSNFTTPEEVPTGTKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNL
VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQ
RIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHA
RERASEYSPASLDAFGAFLKSCV
Download sequence
Identical sequences H2PLK9
9600.ENSPPYP00000019491 ENSPPYP00000019491 XP_009240863.1.23681 XP_009240864.1.23681 ENSPPYP00000019491 ENSPPYP00000023823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]