SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000020510 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000020510
Domain Number 1 Region: 69-128
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-20
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 2 Region: 5-65
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000162
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000020510
Sequence length 134
Comment (Pongo pygmaeus)
Sequence
LPSHTCGNPGEILKGVLHGTRFNIGDKIRYSCLSGYILEGHAILTCIVSPGNGASWDFPA
PFCRAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTIALVFTDFQLEEGY
DFLEISGTEAPSIW
Download sequence
Identical sequences G7N0E9 G7PCC2 H2PPE1
ENSPPYP00000020510 ENSPPYP00000020510 ENSGGOP00000012180 ENSGGOP00000012180 9600.ENSPPYP00000020510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]