SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000020942 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000020942
Domain Number 1 Region: 69-116
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000981
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 2 Region: 30-71
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000301
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000020942
Sequence length 259
Comment (Pongo pygmaeus)
Sequence
MALCALARLWPGAQAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQTCRLTGDCCFD
YDRACPARPCFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGGAPCPPLEERAGCLEYS
TPQGQGCGHSYVPAFITTSAFNKERTRQATSPHWSTHTEDAGYCMEFKTESLTPHCALEN
RPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWK
KVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences H2PQJ9
9600.ENSPPYP00000020942 ENSPPYP00000020942 ENSPPYP00000020942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]