SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000021180 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000021180
Domain Number 1 Region: 366-449
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.64e-18
Family HLH, helix-loop-helix DNA-binding domain 0.00000788
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000021180
Sequence length 453
Comment (Pongo pygmaeus)
Sequence
LDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSPRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA
RGHSVSSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSLPKSCTSPDSSAFSPSSDSLLS
STESSPQASPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSEGSPSDGG
HIKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPR
SSDAEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSI
QAEEQKLISEKDLLRKRREQLKHKLEQLRNSCA
Download sequence
Identical sequences H2PR71
ENSPPYP00000021181 9600.ENSPPYP00000021180 ENSPPYP00000021181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]