SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000022974 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9600.ENSPPYP00000022974
Domain Number - Region: 271-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000391
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000022974
Sequence length 301
Comment (Pongo pygmaeus)
Sequence
MSSPTKEGSDTAGNAHKNSENEPSNDFSTDIESPSADPNMIYQVETNPINREPDTATSQE
DVVPQAAENSELETEIQKDQREEDIKEESLLLQIPIPRKLVSHKPLNDRSRSHSGKVEMK
ANNFRINHKTRFRLSTSWRVPFISNHEIRSMILRLLCDRYFFQAAGCQNTMWVKQKYIAC
LYHPNSFTHHERAIIFRRPSRVHYYRPLTERMTSGKFFKSTDTKGKCRFRAIVRSVLFVS
QMQIQSIFNRKGFVDILRYSHTMKVMIINTNNGWKYFCPICGRLFNTYSELRQHSWSSSG
N
Download sequence
Identical sequences H2PW67
ENSPPYP00000022974 ENSPPYP00000022974 9600.ENSPPYP00000022974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]