SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000196169 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000196169
Domain Number 1 Region: 555-611
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000143
Family Tudor domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 190-244
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000086
Family UBA domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000196169
Sequence length 651
Comment (Homo sapiens)
Sequence
MLRLQMTDGHISCTAVEFSYMSKISLNTPPGTKVKLSGIVDIKNGFLLLNDSNTTVLGGE
VEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHVQVDSRELDRRKTLQVTMP
VKPTNDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNMNAAGNRNREVLQKEKST
KSEGKHEGVYRELVDEKALKHITEMGFSKEASRQALMDNGNNLEAALNVLLTSNKQKPVM
GPPLRGRGKGRGRIRSEDEEDLGNARPSAPSTLFDFLESKMGTLNVEEPKSQPQQLHQGQ
YRSSNTEQNGVKDNNHLRHPPRNDTRQPRNEKPPRFQRDSQNSKSVLEGSGLPRNRGSER
PSTSSVSEVWAEDRIKCDRPYSRYDRTKDTSYPLGSQHSDGAFKKRDNSMQSRSGKGPSF
AEAKENPLPQGSVDYNNQKRGKRESQTSIPDYFYDRKSQTINNEAFSGIKIEKHFNVNTD
YQNPVRSNSFIGVPNGEVEMPLKGRRIGPIKPAGPVTAVPCDDKIFYNSGPKRRSGPIKP
EKILESSIPMEYAKMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEV
LLSNIKPIQTEAWEEEGTYDQTLEFRRGGDGQPRRSTRPTQQFYQPPRARN
Download sequence
Identical sequences A0A024QZE0 Q9H7E2
gi|13540576|ref|NP_110421.1| gi|225703108|ref|NP_001139543.1| ENSP00000196169 ENSP00000367113 ENSP00000367126 NP_001139543.1.87134 NP_001139543.1.92137 NP_110421.1.87134 NP_110421.1.92137 ENSP00000196169 ENSP00000367113 ENSP00000367126 9606.ENSP00000196169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]