SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000210633 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000210633
Domain Number 1 Region: 36-505
Classification Level Classification E-value
Superfamily Sema domain 4.84e-148
Family Sema domain 0.00000000777
Further Details:      
 
Domain Number 2 Region: 508-546
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000366
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 573-662
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000256
Family I set domains 0.033
Further Details:      
 
Weak hits

Sequence:  9606.ENSP00000210633
Domain Number - Region: 770-779
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0994
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000210633
Sequence length 843
Comment (Homo sapiens)
Sequence
MWGRLWPLLLSILTATAVPGPSLRRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLL
LEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCHQKGKNNQTECFNHVR
FLQRLNSTHLYACGTHAFQPLCAAIDAEAFTLPTSFEEGKEKCPYDPARGFTGLIIDGGL
YTATRYEFRSIPDIRRSRHPHSLRTEETPMHWLNDAEFVFSVLVRESKASAVGDDDKVYY
FFTERATEEGSGSFTQSRSSHRVARVARVCKGDLGGKKILQKKWTSFLKARLICHIPLYE
TLRGVCSLDAETSSRTHFYAAFTLSTQWKTLEASAICRYDLAEIQAVFAGPYMEYQDGSR
RWGRYEGGVPEPRPGSCITDSLRSQGYNSSQDLPSLVLDFVKLHPLMARPVVPTRGRPLL
LKRNIRYTHLTGTPVTTPAGPTYDLLFLGTADGWIHKAVVLGSGMHIIEETQVFRESQSV
ENLVISLLQHSLYVGAPSGVIQLPLSSCSRYRSCYDCILARDPYCGWDPGTHACAAATTI
ANRSQGSRTALIQDIERGNRGCESSRDTGPPPPLKTRSVLRGDDVLLPCDQPSNLARALW
LLNGSMGLSDGQGGYRVGVDGLLVTDAQPEHSGNYGCYAEENGLRTLLASYSLTVRPATP
APAPKAPATPGAQLAPDVRLLYVLAIAALGGLCLILASSLLYVACLREGRRGRRRKYSLG
RASRAGGSAVQLQTVSGQCPGEEDEGDDEGAGGLEGSCLQIIPGEGAPAPPPPPPPPPPA
ELTNGLVALPSRLRRMNGNSYVLLRQSNNGVPAGPCSFAEELSRILEKRKHTQLVEQLDE
SSV
Download sequence
Identical sequences NP_060363.2.87134 NP_060363.2.92137 XP_005270065.1.92137 ENSP00000359270 gi|28872814|ref|NP_060363.2| ENSP00000210633 ENSP00000210633 9606.ENSP00000210633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]