SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000216085 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000216085
Domain Number 1 Region: 20-180
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00000000000628
Family Rhomboid-like 0.0064
Further Details:      
 
Domain Number 2 Region: 315-362
Classification Level Classification E-value
Superfamily UBA-like 0.00000108
Family UBA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000216085
Sequence length 386
Comment (Homo sapiens)
Sequence
MHARGPHGQLSPALPLASSVLMLLMSTLWLVGAGPGLVLAPELLLDPWQVHRLLTHALGH
TALPGLLLSLLLLPTVGWQQECHLGTLRFLHASALLALASGLLAVLLAGLGLSSAAGSCG
YMPVHLAMLAGEGHRPRRPRGALPPWLSPWLLLALTPLLSSEPPFLQLLCGLLAGLAYAA
GAFRWLEPSERRLQVLQEGVLCRTLAGCWPLRLLATPGSLAELPVTHPAGVRPPIPGPPY
VASPDLWSHWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEG
IQASLLDGPAQEPQSAPWLSKSSVSSLRLQQLERMGFPTEQAVVALAATGRVEGAVSLLV
GGQVGTETLVTHGKGGPAHSEGPGPP
Download sequence
Identical sequences A0A024R1J2 Q9Y3P4
ENSP00000216085 ENSP00000216085 NP_036397.1.87134 NP_036397.1.92137 XP_011528409.1.92137 ENSP00000216085 9606.ENSP00000216085 gi|11072101|ref|NP_036397.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]