SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000222305 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000222305
Domain Number 1 Region: 227-302
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000637
Further Details:      
 
Weak hits

Sequence:  9606.ENSP00000222305
Domain Number - Region: 293-333
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0182
Family Leucine zipper domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000222305
Sequence length 346
Comment (Homo sapiens)
Sequence
MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFG
DHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVSVVSTAAFAGGQQAVTQVGVD
GAAQRPGPAAASVPPGPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTA
VSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQH
NEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQET
FKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ
Download sequence
Identical sequences A0A2J8RRB5 K7BF58 Q15853
ENSP00000222305 NP_003358.1.87134 NP_003358.1.92137 gi|4507847|ref|NP_003358.1| ENSP00000222305 9606.ENSP00000222305 HR6458 ENSP00000222305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]