SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000223428 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000223428
Domain Number 1 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.35e-26
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 40-102
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.2e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 552-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 496-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 609-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 6 Region: 402-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7e-21
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 238-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000205
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000223428
Sequence length 683
Comment (Homo sapiens)
Sequence
MSPHPEAITDCVTLNTVGQLAEGGYPLRFSTLFQEQQKMNISQASVSFKDVTIEFTQEEW
QQMAPVQKNLYRDVMLENYSNLVSVGYCCFKPEVIFKLEQGEEPWFSEEEFSNQSHPKDY
RGDDLIKQNKKIKDKHLEQAICINNKTLTTEEEKVLGKPFTLHVAAVASTKMSCKCNSWE
VNLQSISEFIINNRNYSTKKIGCGNVCENSPFKINFEKTQTGEKFYEHNKNMKALNYNEN
LPKHPKFQTLEQAFECNKIGKAFNDKANCVKHNSSHTGETSSKDDEFRKNCDKKTLFDHR
RTGTGKKHLHLNQCGKSFEKSTVEEYNKLNMGIKHYELNPSGNNFNRKAHLTDPQTAVIE
ENPLVSNDRTQTWVKSSEYHENKKSYQTSVHRVRRRSHSMMKPYKCNECGKSFCQKGHLI
QHQRTHTGEKPFECSECGKTFSQKSHLSTHQRIHTAEKPYKCNECGKTFVQKSTLRGHQR
IHTGEKPYECSECGKTFVQKSTLRDHHRIHTGEKSFQCNQCGKTFGQKSNLRIHQRTHTG
EKTYQCNECEKSFWRKDHLIQHQKTHTGEKPFKCNECGKTFARTSTLRVHQRIHTGEKPF
KCNECGKKFVRKAILSDHQRIHTGEKPFQCNKCGKTFGQKSNLRIHQRTHSGEKSYECNE
YGKLCKKSTLSLYQKIQGEGNPY
Download sequence
Identical sequences Q9Y2H8
ENSP00000223428 ENSP00000364379 ENSP00000223428 NP_001300988.1.87134 NP_001300988.1.92137 NP_055745.1.87134 NP_055745.1.92137 XP_016869972.1.92137 9606.ENSP00000223428 gi|7662424|ref|NP_055745.1| ENSP00000223428 ENSP00000364379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]