SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000228027 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9606.ENSP00000228027
Domain Number - Region: 255-284,320-370
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.0131
Family Glycerol-3-phosphate (1)-acyltransferase 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000228027
Sequence length 388
Comment (Homo sapiens)
Sequence
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLN
RSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKG
GRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATE
VSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGG
AAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQ
KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHT
MYMEALVKLFDKHKTKFGLPETEVLEVN
Download sequence
Identical sequences G3QK91 H2Q4F5 Q96PD7
ENSP00000228027 ENSPTRP00000007025 ENSP00000228027 GO.36796 ENSGGOP00000002861 ENSP00000228027 gi|26024197|ref|NP_115953.2| NP_115953.2.87134 NP_115953.2.92137 XP_003814755.1.60992 XP_004051883.1.27298 XP_522113.3.37143 ENSPTRP00000007025 9598.ENSPTRP00000007025 9606.ENSP00000228027 ENSGGOP00000002861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]