SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000231121 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000231121
Domain Number 1 Region: 95-154
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000231121
Sequence length 215
Comment (Homo sapiens)
Sequence
MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGG
PPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELREC
IPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRE
LQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ
Download sequence
Identical sequences O96004
ENSP00000231121 gi|4758506|ref|NP_004812.1| ENSP00000231121 NP_004812.1.87134 NP_004812.1.92137 9606.ENSP00000231121 ENSP00000231121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]