SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000233957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000233957
Domain Number 1 Region: 365-522
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.83e-30
Family Toll/Interleukin receptor TIR domain 0.00032
Further Details:      
 
Domain Number 2 Region: 220-313
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000329
Family I set domains 0.074
Further Details:      
 
Domain Number 3 Region: 25-107
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000315
Family I set domains 0.04
Further Details:      
 
Weak hits

Sequence:  9606.ENSP00000233957
Domain Number - Region: 128-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000612
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000233957
Sequence length 541
Comment (Homo sapiens)
Sequence
MNCRELPLTLWVLISVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSS
GSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCF
TERQVTSKIVEVKKFFQITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQ
GYYSCVHFLHHNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSAL
LNEEDVIYWMFGEENGSDPNIHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTV
ASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAVLILVAVVCLVTVCVIYRVDLVLFYR
HLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVV
PGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVT
DFTFLPQSLKLLKSHRVLKWKADKSLSYNSRFWKNLLYLMPAKTVKPGRDEPEVLPVLSE
S
Download sequence
Identical sequences Q13478
ENSP00000233957 ENSP00000386663 ENSP00000387211 NP_003846.1.87134 NP_003846.1.92137 ENSP00000233957 ENSP00000386663 ENSP00000387211 NYSGRC-IgSF-IL18R_HUMAN ENSP00000233957 gi|4504655|ref|NP_003846.1| 9606.ENSP00000233957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]