SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000234038 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000234038
Domain Number 1 Region: 79-354
Classification Level Classification E-value
Superfamily L domain-like 1.36e-54
Family Internalin LRR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000234038
Sequence length 360
Comment (Homo sapiens)
Sequence
MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPE
EEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQ
SLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIE
NLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSN
RLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQE
FWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF
Download sequence
Identical sequences A0A140VK83 G3RAM0 Q15435
ENSP00000234038 ENSP00000385657 gi|4506013|ref|NP_002703.1| 9606.ENSP00000234038 ENSP00000234038 ENSP00000385657 ENSP00000385022 NP_002703.1.87134 NP_002703.1.92137 XP_003813113.1.60992 XP_004033524.1.27298 ENSGGOP00000012493 ENSGGOP00000012493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]