SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000261942 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000261942
Domain Number 1 Region: 129-276
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.38e-34
Family UAS domain 0.03
Further Details:      
 
Domain Number 2 Region: 313-443
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-20
Family UBX domain 0.0053
Further Details:      
 
Domain Number 3 Region: 10-48
Classification Level Classification E-value
Superfamily UBA-like 0.0000578
Family TAP-C domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000261942
Sequence length 445
Comment (Homo sapiens)
Sequence
MAAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGVPSV
FNPPPSRPLQVNTADHRIYSYVVSRPQPRGLLGWGYYLIMLPFRFTYYTILDIFRFALRF
IRPDPRSRVTDPVGDIVSFMHSFEEKYGRAHPVFYQGTYSQALNDAKRELRFLLVYLHGD
DHQDSDEFCRNTLCAPEVISLINTRMLFWACSTNKPEGYRVSQALRENTYPFLAMIMLKD
RRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVLRQQQDEAYLAS
LRADQEKERKKREERERKRRKEEEVQQQKLAEERRRQNLQEEKERKLECLPPEPSPDDPE
SVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEW
PNPPTLQEAGLSHTEVLFVQDLTDE
Download sequence
Identical sequences Q96CS3
ENSP00000261942 ENSP00000261942 9606.ENSP00000261942 gi|24797106|ref|NP_055428.1| HT42 ENSP00000424146 NP_055428.1.87134 NP_055428.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]