SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000270235 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000270235
Domain Number 1 Region: 345-473
Classification Level Classification E-value
Superfamily TIMP-like 3.61e-29
Family Tissue inhibitor of metalloproteinases, TIMP 0.026
Further Details:      
 
Domain Number 2 Region: 212-265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000257
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 3 Region: 157-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family EGF-type module 0.07
Further Details:      
 
Domain Number 4 Region: 275-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000270235
Sequence length 489
Comment (Homo sapiens)
Sequence
MPVTFALLLLLGQATADPCYDPQGRPQFCLPPVTQLAAVAASCPQACALSPGNHLGARET
CNGSLTLALGGPFLLTSVSLRFCTPGPPALILSAAWASGGPWRLLWHRPAWPGALGGPER
VTFHSTPGPKATVAASHLRVEFGGQAGLAAAGLRGRCQCHGHAARCAARARPPRCHCRHH
TTGPGCESCRPSHRDWPWRPATPRHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCE
RCRHHTAGRHCHYCQPGFWRDPSQPIFSRRACRACQCHPIGATGGTCNQTSGQCTCKLGV
TGLTCNRCGPGYQQSRSPRMPCQRIPEATTTLATTPGAYSSDPQCQNYCNMSDTRVHMSL
RRYCQQDHVLRAQVLASEAAGPAWQRLAVRVLAVYKQRAQPVRRGDQDAWVPRADLTCGC
LRLQPGTDYLLLGSAVGDPDPTRLILDRHGLALPWRPRWARPLKRLQQEERAGGCRGVRA
PTPSPRPEH
Download sequence
Identical sequences Q8WTR8
ENSP00000270235 ENSP00000270235 NP_665806.1.87134 NP_665806.1.92137 9606.ENSP00000270235 gi|24308065|ref|NP_665806.1| ENSP00000270235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]